PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.VAQ68
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 221aa    MW: 25500.8 Da    PI: 8.2914
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.VAQ68genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
      Aradu.VAQ68 14 KGLWSPEEDEKLLNYITNHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-28664IPR009057Homeodomain-like
PROSITE profilePS5129424.478965IPR017930Myb domain
SuperFamilySSF466893.17E-2312100IPR009057Homeodomain-like
SMARTSM007172.9E-121363IPR001005SANT/Myb domain
PfamPF002495.1E-161461IPR001005SANT/Myb domain
CDDcd001671.34E-101761No hitNo description
Gene3DG3DSA:1.10.10.603.8E-1665108IPR009057Homeodomain-like
SMARTSM007170.8766106IPR001005SANT/Myb domain
PROSITE profilePS512948.48866108IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT NHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQEEEDLIIE LHAIAARLPG RTDNEIKNLW NSCLKKKLRQ KGIDPITNKP  120
LSDVQMMNNF GATPPNATSS DANFVANNIL TWEQEEVKWC EYLNTLLLNN TVITEPETTS  180
FMRQDSSSSS WHHHSQQQPH QFSDMYTKDL QRFSVAFGQS M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-21121085108B-MYB
1h8a_C1e-201210825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103109LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015939578.11e-136PREDICTED: transcription factor MYB86-like
RefseqXP_015939577.11e-136PREDICTED: transcription factor MYB86-like
SwissprotQ8LPH63e-79MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A0B2RZ163e-80A0A0B2RZ16_GLYSO; Transcription factor MYB86
TrEMBLG7IAD12e-80G7IAD1_MEDTR; Myb transcription factor
TrEMBLI1LAY23e-80I1LAY2_SOYBN; MYB/HD-like transcription factor
STRINGGLYMA10G28250.17e-80(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.11e-80myb domain protein 50